PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1080s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 207aa    MW: 23579.7 Da    PI: 9.9197
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1080s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.52.3e-251059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         +i++++ rqvtfskRr+g++KKA+EL +LCdaev +iifs+t+kly+++s
  Cagra.1080s0003.1.p 10 KIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLIIFSNTDKLYDFAS 59
                         79**********************************************86 PP

2K-box332.6e-1259943469
                K-box 34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69
                         + R+l G++L+ L +k+Lq+Le+qLe sl+ iR kK
  Cagra.1080s0003.1.p 59 SSRQLTGQQLNGLGVKQLQNLESQLEMSLRGIRMKK 94
                         57*********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.885161IPR002100Transcription factor, MADS-box
SMARTSM004325.4E-37160IPR002100Transcription factor, MADS-box
CDDcd002657.56E-33260No hitNo description
SuperFamilySSF554551.7E-26261IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-252338IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.37837154IPR002487Transcription factor, K-box
PRINTSPR004041.4E-253859IPR002100Transcription factor, MADS-box
PfamPF014864.1E-1359148IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MGRGKIVIQK IDDSTSRQVT FSKRRKGLIK KAKELAILCD AEVGLIIFSN TDKLYDFASS  60
RQLTGQQLNG LGVKQLQNLE SQLEMSLRGI RMKKIYESSS SRSCWTNDIQ TNQSFRTLQE  120
QILTNEIKEL TRKRNLVHHE NLELSRKVQR IHQENIELYK KAYATSNANG LGNNELVDAV  180
DESHAEVRLQ LSQPEQSHYE TSSKSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-17160160Myocyte-specific enhancer factor 2B
1tqe_R7e-17160160Myocyte-specific enhancer factor 2B
1tqe_Q7e-17160160Myocyte-specific enhancer factor 2B
1tqe_P7e-17160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0063408e-83AC006340.5 Arabidopsis thaliana chromosome 2 clone T9I22 map CIC06C07, complete sequence.
GenBankCP0026858e-83CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294943.11e-114hypothetical protein CARUB_v10023996mg
SwissprotQ388401e-103AGL17_ARATH; Agamous-like MADS-box protein AGL17
TrEMBLR0FYJ81e-114R0FYJ8_9BRAS; Uncharacterized protein
STRINGAT2G22630.11e-101(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22630.11e-104AGAMOUS-like 17